PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000842G0540
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GRF
Protein Properties Length: 213aa    MW: 22503.6 Da    PI: 9.354
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000842G0540genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC81.38.3e-26130174145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      ++epgrCrRtDGKkWRCsr+v++g+k+CErH+hrgr rsrks+e+
  PH01000842G0540 130 EPEPGRCRRTDGKKWRCSRDVVPGHKYCERHVHRGRGRSRKSVEA 174
                      69****************************************986 PP

2QLQ53.47.7e-1964100137
              QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                      sa+T +Q q+L++Q+l+y+y+aa++PvP +L+++i+k
  PH01000842G0540  64 SALTFMQQQELEHQVLIYRYFAAGAPVPVHLVLPIWK 100
                      799*********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.5E-664100IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.8E-116599IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.22565100IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.724130174IPR014977WRC domain
PfamPF088792.3E-21131173IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MAEEKEADSP QPPSKLPRLS CADPNAGAVT MADSSPLVLG LGLGLGGDSC GERGVEAPAA  60
HKASALTFMQ QQELEHQVLI YRYFAAGAPV PVHLVLPIWK SVAASSFGPH RFPSLMGLGS  120
LCFDYRSSME PEPGRCRRTD GKKWRCSRDV VPGHKYCERH VHRGRGRSRK SVEAATTTPA  180
PNGSSSSISA SPRGLGFSPT SVLLAHSAAR AT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0997370.0FP099737.1 Phyllostachys edulis cDNA clone: bphyst023e19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006647685.11e-106PREDICTED: growth-regulating factor 10
SwissprotQ6EPP91e-105GRF10_ORYSJ; Growth-regulating factor 10
TrEMBLA0A0E0K3L71e-111A0A0E0K3L7_ORYPU; Uncharacterized protein
STRINGSi018252m1e-105(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62213051
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36400.12e-38growth-regulating factor 3